Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagenase 3 (MMP13), partial

Product Specifications

Product Name Alternative

Matrix metalloproteinase-13

Abbreviation

Recombinant Human MMP13 protein, partial

Gene Name

MMP13

UniProt

P45452

Expression Region

195-471aa

Organism

Homo sapiens (Human)

Target Sequence

YGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Developmental Biology

Relevance

Plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with soluble type II collagen. Can also degrade collagen type IV, type XIV and type X. May also function by activating or degrading key regulatory proteins, such as TGFB1 and CCN2. Plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization and ossification. Required for normal embryonic bone development and ossification. Plays a role in the healing of bone fractures via endochondral ossification. Plays a role in wound healing, probably by a mechanism that involves proteolytic activation of TGFB1 and degradation of CCN2. Plays a role in keratinocyte migration during wound healing. May play a role in cell migration and in tumor cell invasion

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12orf59 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0292405 3x 1.0 µg

C12orf59 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
AMPD2 Protein Vector (Human) (pPB-His-MBP)
PV321610 500 ng

AMPD2 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Galectin 3 Rabbit Polyclonal Antibody (BF350)
orb1590615 100 µL

Galectin 3 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Rat BMP10 shRNA Plasmid
abx990959-01 150 µg

Rat BMP10 shRNA Plasmid

Sign In for Pricing
View Details
Rat BMP10 shRNA Plasmid
abx990959-02 300 µg

Rat BMP10 shRNA Plasmid

Sign In for Pricing
View Details
Porcine PNLIP (Pancreatic triacylglycerol lipase) ELISA Kit
EP0348 96 Tests

Porcine PNLIP (Pancreatic triacylglycerol lipase) ELISA Kit

Sign In for Pricing
View Details