Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C8orf34 (C8orf34)

Product Specifications

Product Name Alternative

Protein VEST-1

Abbreviation

Recombinant Human C8orf34 protein

Gene Name

C8orf34

UniProt

Q49A92

Expression Region

1-538aa

Organism

Homo sapiens (Human)

Target Sequence

MSSPLASELSELAALRPGFRLSAPHARVAPRAATHARGRGRASHAGQPRLRSSCPGPSPGKRRVVPSGGAQPRVLPALSSRSHLFPMASHPQTRIQAYLEKNKIGPLFEELMTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESKGTRRDFRSYDKPWQLNAKKPKKSKSDLAVSNISPPSPDSKSLPRSVEHPKWNWRTKPQSRDFDELNHILQESKKLGKALENLSRSIAISDELDKETVTFNSSLLRPRVIGEWIGREENDADPLAAEMLQPPIPRSKNDQWESEDSGSSPAGSLKMEPKNKGLKQQQQQHKKLLAAMLSQDSFESIHSPTPSVTEEDIDNEDDAMELLEDLNDLRMEGVTTLVPSGSKFNQGRPTYPAEPQAKVTLNICSRCARLQGDNLEERTEESLPILHSPDEKIPDSFDSLPGTEEALMEEGDEFEKASKLTGPGEASSGVGHSLKNYMEEDESLKQLQVVHQPWILPSDTESEGVEAEQEKRSADLLLCVPCSSCPTLVYSGL

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

66.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TRAIL/TNFSF10 Antibody (B-S23) [DyLight 755]
NBP3-14602IR 0.1 mL

Mouse Monoclonal TRAIL/TNFSF10 Antibody (B-S23) [DyLight 755]

Sign In for Pricing
View Details
C15ORF26 antibody
70R-4410 50 ug

C15ORF26 antibody

Sign In for Pricing
View Details
ABAT Mouse Monoclonal Antibody [Clone ID: OTI6H9]
TA806965 100 µL

ABAT Mouse Monoclonal Antibody [Clone ID: OTI6H9]

Sign In for Pricing
View Details
MEF2A Rabbit Polyclonal Antibody
AP02582PU-S 50 µL

MEF2A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal PDK4 Antibody [Alexa Fluor 532]
NBP1-07047AF532 0.1 mL

Rabbit Polyclonal PDK4 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
SPTBN1 siRNA (Mouse)
CRM3893-01 15 nmol

SPTBN1 siRNA (Mouse)

Sign In for Pricing
View Details