Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83)

Product Specifications

Product Name Alternative

Cancer/testis antigen 83

Abbreviation

Recombinant Human CT83 protein

Gene Name

CT83

UniProt

Q5H943

Expression Region

1-113aa

Organism

Homo sapiens (Human)

Target Sequence

MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Zinc finger protein 513, Znf513 ELISA KIT
ELI-14792m 96 Tests

Mouse Zinc finger protein 513, Znf513 ELISA KIT

Sign In for Pricing
View Details
Mouse Monoclonal ACD Antibody (OTI1A2) [Alexa Fluor 532]
NBP2-72170AF532 0.1 mL

Mouse Monoclonal ACD Antibody (OTI1A2) [Alexa Fluor 532]

Sign In for Pricing
View Details
Human Dipeptidyl peptidase 3, DPP3 ELISA KIT
ELI-32838h 96 Tests

Human Dipeptidyl peptidase 3, DPP3 ELISA KIT

Sign In for Pricing
View Details
(2RS,3RS) -3- (2-ethoxyphenoxy) -2-methanesulfonyloxy-1- (4-nitrobenzoyloxy) -3-phenylpropane
E8577-20 25 mg

(2RS,3RS) -3- (2-ethoxyphenoxy) -2-methanesulfonyloxy-1- (4-nitrobenzoyloxy) -3-phenylpropane

Sign In for Pricing
View Details
Lentiviral human TBCK sgRNA gene knockout kit - Lentiviral human TBCK sgRNA gene knockout kit (100)
GTR15390160 1 Vial

Lentiviral human TBCK sgRNA gene knockout kit - Lentiviral human TBCK sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
PLSCR3 Rabbit mAb
MBS9147552-01 0.02 mL

PLSCR3 Rabbit mAb

Sign In for Pricing
View Details