Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Interferon gamma (IFNG) (Active)

Product Specifications

Product Name Alternative

Interferon gamma; IFN-gamma; IFNG

Abbreviation

Recombinant Rhesus macaque IFNG protein (Active)

Gene Name

IFNG

UniProt

P63310

Expression Region

24-165aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Macaca mulatta IFNG at 2 μg/mL can bind anti-IFNG recombinant antibody (CSB-RA011050MA1HU) .The EC50 is 35.23-38.98 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.1 kDa

References & Citations

Replication, immunogenicity, and protective properties of live-attenuated simian immunodeficiency viruses expressing interleukin-4 or interferon- gamma. Stahl-Hennig C., Gundlach B.R., Dittmer U., ten Haaft P., Heeney J., Zou W., Emilie D., Sopper S., Uberla K. Virology 305:473-485 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BBS4 Antibody (Center) Blocking Peptide
MBS9227001-01 0.5 mg

BBS4 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
BBS4 Antibody (Center) Blocking Peptide
MBS9227001-02 5x 0.5 mg

BBS4 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
Amuvatinib (MP-470)
S1244-50mg 50 mg

Amuvatinib (MP-470)

Sign In for Pricing
View Details
RAB39A antibody
70R-51384 100 ul

RAB39A antibody

Sign In for Pricing
View Details
MINPP1 Antibody
E19-4189 100 µg -100 µL

MINPP1 Antibody

Sign In for Pricing
View Details
YAP Polyclonal Antibody
JOT-AP09632-01 50ul

YAP Polyclonal Antibody

Sign In for Pricing
View Details