Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Leukocyte surface antigen CD47 (CD47), partial (Active)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Rhesus macaque CD47 protein, partial (Active)

Gene Name

CD47

UniProt

F7A802

Expression Region

19-141aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTAPANFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Leukocyte surface antigen CD47; Integrin-associated protein; CD47

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta CD47 at 2 μg/mL can bind Anti-CD47 recombinant antibody (CSB-RA004940MA1HU) . The EC50 is 4.473-4.933 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.3 kDa

References & Citations

Evolutionary and biomedical insights from the rhesus macaque genome. Gibbs R.A., Rogers J., Katze M.G., Bumgarner R., Weinstock G.M., Mardis E.R., Remington K.A., Strausberg R.L., Venter J.C., Zwieg A.S. Science 316:222-234 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Klebsiella Pneumoniae thrL Protein (aa 1-22)
VAng-Cr5478-50gEcoli 50 µg (E. coli)

Recombinant Klebsiella Pneumoniae thrL Protein (aa 1-22)

Sign In for Pricing
View Details
Sf1 (NM_058210) Rat Untagged Clone
RN200215 10 µg

Sf1 (NM_058210) Rat Untagged Clone

Sign In for Pricing
View Details
Rabbit anti-RPN1/Ribophorin I Antibody, Affinity Purified
MBS3905176-01 0.01 mg

Rabbit anti-RPN1/Ribophorin I Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-RPN1/Ribophorin I Antibody, Affinity Purified
MBS3905176-02 0.1 mg

Rabbit anti-RPN1/Ribophorin I Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-RPN1/Ribophorin I Antibody, Affinity Purified
MBS3905176-03 5x 0.01 mg

Rabbit anti-RPN1/Ribophorin I Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-RPN1/Ribophorin I Antibody, Affinity Purified
MBS3905176-04 5x 0.1 mg

Rabbit anti-RPN1/Ribophorin I Antibody, Affinity Purified

Sign In for Pricing
View Details