Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secretogranin-3 (SCG3)

Product Specifications

Product Name Alternative

Secretogranin III

Abbreviation

Recombinant Human SCG3 protein

Gene Name

SCG3

UniProt

Q8WXD2

Expression Region

20-468aa

Organism

Homo sapiens (Human)

Target Sequence

FPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPPENKPGQSNYSFVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHKFQDDPDGLHQLDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLKKHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSL

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Neuroscience

Relevance

Member of the granin protein family that regulates the biogenesis of secretory granules. Acts as a sorting receptor for intragranular proteins including chromogranin A/CHGA. May also play a role in angiogenesis. Promotes endothelial proliferation, migration and tube formation through MEK/ERK signaling pathway

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

79.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

trans-2,cis-6-Nonadienal-D5 (>90%)
TRC-N649368-1MG 1 mg

trans-2,cis-6-Nonadienal-D5 (>90%)

Sign In for Pricing
View Details
Recombinant Keratin 4 Monoclonal Antibody
AN301580L-01 50 µL

Recombinant Keratin 4 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Keratin 4 Monoclonal Antibody
AN301580L-02 100 µL

Recombinant Keratin 4 Monoclonal Antibody

Sign In for Pricing
View Details
FSTL4 (NM_015082) Human Recombinant Protein
TP319694M 100 µg

FSTL4 (NM_015082) Human Recombinant Protein

Sign In for Pricing
View Details
4-Cyanophenylhydrazine Hydrochloride
TRC-C987535-1G 1 g

4-Cyanophenylhydrazine Hydrochloride

Sign In for Pricing
View Details
GRAMD1B Human Gene Knockout Kit (CRISPR)
KN219269BN 1 Kit

GRAMD1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details