Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galectin-9 (LGALS9), partial, Biotinylated

Product Specifications

Product Name Alternative

Ecalectin; Tumor antigen HOM-HD-21

Abbreviation

Recombinant Human LGALS9 protein, partial, Biotinylated

Gene Name

LGALS9

UniProt

O00182-2

Expression Region

2-323aa

Organism

Homo sapiens (Human)

Target Sequence

AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Tag

N-terminal hFc1-Avi-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cell Biology

Relevance

Acts as an eosinophil chemoattractant. It also inhibits angiogenesis. Suppresses IFNG production by natural killer cells

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

63.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF568 conjugate, 0.1mg/mL
BNC681373-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SIGLEC11 activation kit by CRISPRa
GA114430 1 Kit

Human SIGLEC11 activation kit by CRISPRa

Sign In for Pricing
View Details
P40 (Rabbit PAb), CF594 conjugate, 0.1mg/mL
BNC940375-500 1x 500 µL

P40 (Rabbit PAb), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DZIP1 Rabbit Polyclonal Antibody
TA360888 100 µL

DZIP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IBP160 (AQR) Human Gene Knockout Kit (CRISPR)
KN420742 1 Kit

IBP160 (AQR) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF792 Human Gene Knockout Kit (CRISPR)
KN424114 1 Kit

ZNF792 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details