Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transforming growth factor beta-1 proprotein (Tgfb1), partial

Product Specifications

Product Name Alternative

Tgfb1

Abbreviation

Recombinant Mouse Tgfb1 protein, partial

Gene Name

Tgfb1

UniProt

P04202

Expression Region

279-390aa

Organism

Mus musculus (Mouse)

Target Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Tag

N-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Transforming growth factor beta-1 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-1 (TGF-beta-1) chains, which constitute the regulatory and active subunit of TGF-beta-1, respectively

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Adiponectin Recombinant Rabbit Monoclonal Antibody [PSH05-32] - BSA and Azide free (Detector)
HA722261 100 µL

Human Adiponectin Recombinant Rabbit Monoclonal Antibody [PSH05-32] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
alpha 1 Antitrypsin (SERPINA1) (NM_001127702) Human Over-expression Lysate
LC426860 20 µg

alpha 1 Antitrypsin (SERPINA1) (NM_001127702) Human Over-expression Lysate

Sign In for Pricing
View Details
rac 1-Lauroyl-2-oleoyl-3-chloropropanediol
TRC-L184760-25MG 25 mg

rac 1-Lauroyl-2-oleoyl-3-chloropropanediol

Sign In for Pricing
View Details
Blonanserin N-Oxide
TRC-B595853-50MG 50 mg

Blonanserin N-Oxide

Sign In for Pricing
View Details
BRUNOL6 (CELF6) (NM_001172684) Human Over-expression Lysate
LC433113 20 µg

BRUNOL6 (CELF6) (NM_001172684) Human Over-expression Lysate

Sign In for Pricing
View Details
BAIAP2 Human qPCR Primer Pair (NM_017451)
HP228582 200 Reactions

BAIAP2 Human qPCR Primer Pair (NM_017451)

Sign In for Pricing
View Details