Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca nemestrina TNF superfamily member 13 (TNFSF13), partial

Product Specifications

Product Name Alternative

A proliferation-inducing ligand

Abbreviation

Recombinant Macaca nemestrina TNFSF13 protein, partial

Gene Name

TNFSF13

UniProt

A0A2K6D7E3

Expression Region

111-250aa

Organism

Macaca nemestrina (pig-tailed macaque)

Target Sequence

QKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIRDAGVYLLYSQVLFQDVTFTMGQVVSREGQGKQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL

Tag

N-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Cytokine that binds to TNFRSF13B/TACI and to TNFRSF17/BCMA. Plays a role in the regulation of tumor cell growth. May be involved in monocyte/macrophage-mediated immunological processes

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SAMD4B Antibody (PCRP-SAMD4B-1H3) [Janelia Fluor 525]
NBP3-14152JF525 0.1 mL

Mouse Monoclonal SAMD4B Antibody (PCRP-SAMD4B-1H3) [Janelia Fluor 525]

Sign In for Pricing
View Details
Kcnt2 Rat shRNA Lentiviral Particle (Locus ID 304827)
TL713678V 500 µL Each

Kcnt2 Rat shRNA Lentiviral Particle (Locus ID 304827)

Sign In for Pricing
View Details
Spdya sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3821705 3x 1.0 µg

Spdya sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
FineTest®700 Anti-Mouse CD11c Antibody (N418)
F700-30085-01 50 Tests

FineTest®700 Anti-Mouse CD11c Antibody (N418)

Sign In for Pricing
View Details
FineTest®700 Anti-Mouse CD11c Antibody (N418)
F700-30085-02 100 Tests

FineTest®700 Anti-Mouse CD11c Antibody (N418)

Sign In for Pricing
View Details
NLRP10 (NACHT, LRR and PYD Domains-containing Protein 10, Nucleotide-binding Oligomerization Domain Protein 8, NALP10, NOD8, PYNOD)
MBS6007926-01 0.1 mg

NLRP10 (NACHT, LRR and PYD Domains-containing Protein 10, Nucleotide-binding Oligomerization Domain Protein 8, NALP10, NOD8, PYNOD)

Sign In for Pricing
View Details