Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Inhibin beta B chain (Inhbb)

Product Specifications

Product Name Alternative

Activin beta-B chain

Abbreviation

Recombinant Mouse Inhbb protein

Gene Name

Inhbb

UniProt

Q04999

Expression Region

297-411aa

Organism

Mus musculus (Mouse)

Target Sequence

GLECDGRTSLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGPVNSCCIPTKLSSMSMLYFDDEYNIVKRDVPNMIVEECGCA

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL-2RB/CD122 Protein (Fc Tag)
PKSH032572-01 10 µg

Recombinant Human IL-2RB/CD122 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human IL-2RB/CD122 Protein (Fc Tag)
PKSH032572-02 50 µg

Recombinant Human IL-2RB/CD122 Protein (Fc Tag)

Sign In for Pricing
View Details
ZC3H6 Human Gene Knockout Kit (CRISPR)
KN421141 1 Kit

ZC3H6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GADD45G Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H10]
TA505480AM 100 µL

GADD45G Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H10]

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) ICP8 (HSVI/2045), 0.2mg/mL
BNUB2045-500 1x 500 µL

HSV1 (Herpes Simplex Virus Type I) ICP8 (HSVI/2045), 0.2mg/mL

Sign In for Pricing
View Details
PHYHIPL (NM_032439) Human Recombinant Protein
TP303950 20 µg

PHYHIPL (NM_032439) Human Recombinant Protein

Sign In for Pricing
View Details