Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse T-cell surface glycoprotein CD3 epsilon chain (Cd3e), partial

Product Specifications

Product Name Alternative

T-cell surface antigen T3/Leu-4 epsilon chain

Abbreviation

Recombinant Mouse Cd3e protein, partial

Gene Name

Cd3e

UniProt

P22646

Expression Region

22-108aa

Organism

Mus musculus (Mouse)

Target Sequence

DDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Also participates in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region. In addition to its role as a TCR coreceptor, it serves as a receptor for ITPRIPL1. Ligand recognition inhibits T-cell activation by promoting interaction with NCK1, which prevents CD3E-ZAP70 interaction and blocks the ERK-NFkB signaling cascade and calcium influx

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

11.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMP1 (TIMP Metallopeptidase Inhibitor 1, CLGI, EPA, EPO, FLJ90373, HCI, TIMP) (MaxLight 550)
252667-ML550 100 µL

TIMP1 (TIMP Metallopeptidase Inhibitor 1, CLGI, EPA, EPO, FLJ90373, HCI, TIMP) (MaxLight 550)

Sign In for Pricing
View Details
Etoricoxib Impurity 41
RM-E044341-01 10 mg

Etoricoxib Impurity 41

Sign In for Pricing
View Details
Etoricoxib Impurity 41
RM-E044341-02 25 mg

Etoricoxib Impurity 41

Sign In for Pricing
View Details
Etoricoxib Impurity 41
RM-E044341-03 50 mg

Etoricoxib Impurity 41

Sign In for Pricing
View Details
Etoricoxib Impurity 41
RM-E044341-04 100 mg

Etoricoxib Impurity 41

Sign In for Pricing
View Details
GluR-delta1 discontinued
536773-01 30ul

GluR-delta1 discontinued

Sign In for Pricing
View Details