Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse E3 ubiquitin-protein ligase MARCHF9 (Marchf9)

Product Specifications

Product Name Alternative

Membrane-associated RING finger protein 9; Membrane-associated RING-CH protein IX; RING-type E3 ubiquitin transferase MARCHF9

Abbreviation

Recombinant Mouse Marchf9 protein

Gene Name

Marchf9

UniProt

Q3TZ87

Expression Region

1-348aa

Organism

Mus musculus (Mouse)

Target Sequence

MLKSRLRMFLNELKLLVLTGGGRPRAEPQPRGGGGGGCGWAPFAGCSARDGDGDEEEYYGSEPRARGLAGDKEPRAGPPPPPAPPPPPPGALDALSLSSSLDSGLRTPQCRICFQGPEQGELLSPCRCDGSVRCTHQPCLIRWISERGSWSCELCYFKYQVLAISTKNPLQWQAISLTVIEKVQIAAIVLGSLFLVASISWLIWSSLSPSAKWQRQDLLFQICYGMYGFMDVVCIGLIVHEGSSVYRIFKRWQAVNQQWKVLNYDKTKDVGGDTGGGAAGKPGPRTSRTSPPAGAPTRPPAAQRMRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Cell Biology

Relevance

E3 ubiquitin-protein ligase that may mediate ubiquitination of MHC-I, CD4 and ICAM1, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNOT2 Polyclonal Antibody, PerCP Conjugated
bs-9383R-PerCP 100 µL

CNOT2 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
CCAAT/Enhancer Binding Protein α (C/EBPα) Guinea Pig ELISA Kit
B9896 96 Tests

CCAAT/Enhancer Binding Protein α (C/EBPα) Guinea Pig ELISA Kit

Sign In for Pricing
View Details
Mouse Sdccag1 Antibody (N-term) Blocking Peptide
MBS9224124-01 0.5 mg

Mouse Sdccag1 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
Mouse Sdccag1 Antibody (N-term) Blocking Peptide
MBS9224124-02 5x 0.5 mg

Mouse Sdccag1 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
Anti-Human IgG (kappa) mAb
MBS8584700-01 0.1 mg

Anti-Human IgG (kappa) mAb

Sign In for Pricing
View Details
Anti-Human IgG (kappa) mAb
MBS8584700-02 5x 0.1 mg

Anti-Human IgG (kappa) mAb

Sign In for Pricing
View Details