Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6K (LY6K)

Product Specifications

Product Name Alternative

Ly-6K; LY6K; CO16

Abbreviation

Recombinant Human LY6K protein

Gene Name

LY6K

UniProt

Q17RY6

Expression Region

18-138aa

Organism

Homo sapiens (Human)

Target Sequence

DANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG

Tag

C-terminal mFc2a-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Required for sperm migration into the oviduct and male fertility by controlling binding of sperm to zona pellucida. May play a role in cell growth

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 6
548153 200 µL

Interleukin 6

Sign In for Pricing
View Details
Muc13 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7035502 1.0 µg DNA

Muc13 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
4E-BP1 (Phospho 4E-BP1 (Phospho Thr37/46) ) Rabbit mAb
E60M0754 100 µL

4E-BP1 (Phospho 4E-BP1 (Phospho Thr37/46) ) Rabbit mAb

Sign In for Pricing
View Details
Desmin Antibody
R35556-100UG 100 µg

Desmin Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal CD155/PVR Antibody (305) [mFluor Violet 610 SE]
NBP2-90501MFV610 0.1 mL

Rabbit Monoclonal CD155/PVR Antibody (305) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
CAPRIN1 Protein Lysate
OCOA12377-20UG 20 µg

CAPRIN1 Protein Lysate

Sign In for Pricing
View Details