Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transcription factor SOX-2 (Sox2)

Product Specifications

Product Name Alternative

Sox2; Sox-2

Abbreviation

Recombinant Mouse Sox2 protein

Gene Name

Sox2

UniProt

P48432

Expression Region

1-319aa

Organism

Mus musculus (Mouse)

Target Sequence

MYNMMETELKPPGPQQASGGGGGGGNATAAATGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGGGLNQRMDSYAHMNGWSNGSYSMMQEQLGYPQHPGLNAHGAAQMQPMHRYVVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMAQHYQSGPVPGTAKYGTLPLSHM

Tag

C-terminal mFc2a-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Neuroscience

Relevance

Transcription factor that forms a trimeric complex with POU5F1 (OCT3/4) on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Binds to the proximal enhancer region of NANOG. Critical for early embryogenesis and for embryonic stem cell pluripotency. Downstream SRRT target that mediates the promotion of neural stem cell self-renewal. Keeps neural cells undifferentiated by counteracting the activity of proneural proteins and suppresses neuronal differentiation. May function as a switch in neuronal development

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

63.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mast2 Pre-designed siRNA Set A
SI108191A 1 Each

Mouse Mast2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-PC4/SUB1 Antibody Picoband® (monoclonal, 2D13E3), Carrier-free
M02698-1-carrier-free 100 µg/Vial

Anti-PC4/SUB1 Antibody Picoband® (monoclonal, 2D13E3), Carrier-free

Sign In for Pricing
View Details
DCN (decorin, CSCD, DSPG2, PG40, PGII, PGS2, SLRR1B) (Biotin)
245216-Biotin 100 µL

DCN (decorin, CSCD, DSPG2, PG40, PGII, PGS2, SLRR1B) (Biotin)

Sign In for Pricing
View Details
G CSF Antibody
orb1327577 100 µg

G CSF Antibody

Sign In for Pricing
View Details
Human Agmatine ureohydrolase, AGMAT ELISA Kit
MBS166669-01 48 Well

Human Agmatine ureohydrolase, AGMAT ELISA Kit

Sign In for Pricing
View Details
Human Agmatine ureohydrolase, AGMAT ELISA Kit
MBS166669-02 96 Well

Human Agmatine ureohydrolase, AGMAT ELISA Kit

Sign In for Pricing
View Details