Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-type natriuretic peptide (Nppc)

Product Specifications

Product Name Alternative

Nppc; Cnp

Abbreviation

Recombinant Mouse Nppc protein

Gene Name

Nppc

UniProt

Q61839

Expression Region

74-126aa

Organism

Mus musculus (Mouse)

Target Sequence

DLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGSMSGLGC

Tag

N-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Hormone which plays a role in endochondral ossification through regulation of cartilaginous growth plate chondrocytes proliferation and differentiation. May also be vasoactive and natriuretic. Acts by specifically binding and stimulating NPR2 to produce cGMP. Binds the clearance receptor NPR3

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tartarate Resistant Acid Phosphatase 5B (TRAP5B) ELISA Kit
MBS109410-01 48 Well

Human Tartarate Resistant Acid Phosphatase 5B (TRAP5B) ELISA Kit

Sign In for Pricing
View Details
Human Tartarate Resistant Acid Phosphatase 5B (TRAP5B) ELISA Kit
MBS109410-02 96 Well

Human Tartarate Resistant Acid Phosphatase 5B (TRAP5B) ELISA Kit

Sign In for Pricing
View Details
Human Tartarate Resistant Acid Phosphatase 5B (TRAP5B) ELISA Kit
MBS109410-03 5x 96 Well

Human Tartarate Resistant Acid Phosphatase 5B (TRAP5B) ELISA Kit

Sign In for Pricing
View Details
Human Tartarate Resistant Acid Phosphatase 5B (TRAP5B) ELISA Kit
MBS109410-04 10x 96 Well

Human Tartarate Resistant Acid Phosphatase 5B (TRAP5B) ELISA Kit

Sign In for Pricing
View Details
IRX2 Double Nickase Plasmid (h)
sc-408331-NIC 20 µg

IRX2 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
SFXN5 Antibody, HRP conjugated
A61564-50UG 50 µg

SFXN5 Antibody, HRP conjugated

Sign In for Pricing
View Details