Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ehrlichia chaffeensis Co-chaperonin GroES (groES)

Product Specifications

Product Name Alternative

10 kDa chaperonin; Chaperonin-10

Abbreviation

Recombinant Ehrlichia chaffeensis groES protein

Gene Name

GroES

UniProt

Q2GH99

Expression Region

1-94aa

Organism

Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)

Target Sequence

MNLNMLHDNVLIEALEECNSSSPIQLPDSAKKKPTQGKVVAVGPGVYNHSGNILPMTIKVGDVVFYRQWAGNEIEFHDKKYIVMKESDIIAKEA

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Together with the chaperonin GroEL, plays an essential role in assisting protein folding. The GroEL-GroES system forms a nano-cage that allows encapsulation of the non-native substrate proteins and provides a physical environment optimized to promote and accelerate protein folding. GroES binds to the apical surface of the GroEL ring, thereby capping the opening of the GroEL channel

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ceacam16 shRNA (UAS) - Lentiviral mouse Ceacam16 shRNA (UAS, iRFP) plasmid
GTR15212200 1 Vial

Lentiviral mouse Ceacam16 shRNA (UAS) - Lentiviral mouse Ceacam16 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
SLC25A26 Recombinant Protein (Mouse)
RP172652 100 µg

SLC25A26 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Human Neuroglobin (NGB) ELISA Kit
MBS285245-01 48 Tests

Human Neuroglobin (NGB) ELISA Kit

Sign In for Pricing
View Details
Human Neuroglobin (NGB) ELISA Kit
MBS285245-02 96 Tests

Human Neuroglobin (NGB) ELISA Kit

Sign In for Pricing
View Details
Human Neuroglobin (NGB) ELISA Kit
MBS285245-03 5x 96 Tests

Human Neuroglobin (NGB) ELISA Kit

Sign In for Pricing
View Details
Human Neuroglobin (NGB) ELISA Kit
MBS285245-04 10x 96 Tests

Human Neuroglobin (NGB) ELISA Kit

Sign In for Pricing
View Details