Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Growth/differentiation factor 9 (Gdf9)

Product Specifications

Product Name Alternative

GDF-9; Gdf-9

Abbreviation

Recombinant Mouse Gdf9 protein

Gene Name

Gdf9

UniProt

Q07105

Expression Region

307-441aa

Organism

Mus musculus (Mouse)

Target Sequence

GQKAIRSEAKGPLLTASFNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVRHRYGSPVHTMVQNIIYEKLDPSVPRPSCVPGKYSPLSVLTIEPDGSIAYKEYEDMIATRCTCR

Tag

C-terminal 10xHis-HSA-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Required for ovarian folliculogenesis

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

84.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHACS (1-aminocyclopropane-1-carboxylate Synthase-like Protein 1, ACC Synthase-like Protein 1, ACCS) (MaxLight 650)
MBS6401667-01 0.1 mL

PHACS (1-aminocyclopropane-1-carboxylate Synthase-like Protein 1, ACC Synthase-like Protein 1, ACCS) (MaxLight 650)

Sign In for Pricing
View Details
PHACS (1-aminocyclopropane-1-carboxylate Synthase-like Protein 1, ACC Synthase-like Protein 1, ACCS) (MaxLight 650)
MBS6401667-02 5x 0.1 mL

PHACS (1-aminocyclopropane-1-carboxylate Synthase-like Protein 1, ACC Synthase-like Protein 1, ACCS) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain 55989/EAEC) FRDC Polyclonal Antibody
MBS7174473 Inquire

Rabbit anti-Escherichia coli (strain 55989/EAEC) FRDC Polyclonal Antibody

Sign In for Pricing
View Details
Plum (Prunus domestica) Allergen
51-565 1 Each

Plum (Prunus domestica) Allergen

Sign In for Pricing
View Details
Flp Rabbit Polyclonal Antibody
TA160030 100 µL

Flp Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRNAT22 Protein Lysate (Human) with C-Ha Tag
48416031 100 µg

TRNAT22 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details