Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Growth/differentiation factor 9 (Gdf9)

Product Specifications

Product Name Alternative

GDF-9; Gdf-9

Abbreviation

Recombinant Mouse Gdf9 protein

Gene Name

Gdf9

UniProt

Q07105

Expression Region

307-441aa

Organism

Mus musculus (Mouse)

Target Sequence

GQKAIRSEAKGPLLTASFNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVRHRYGSPVHTMVQNIIYEKLDPSVPRPSCVPGKYSPLSVLTIEPDGSIAYKEYEDMIATRCTCR

Tag

C-terminal 10xHis-HSA-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Required for ovarian folliculogenesis

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

84.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

INTS9 Peptide - C-terminal region (AAP70583)
AAP70583-100UG 100 µg

INTS9 Peptide - C-terminal region (AAP70583)

Sign In for Pricing
View Details
CCN2 polyclonal antibody
BS3979 50ul

CCN2 polyclonal antibody

Sign In for Pricing
View Details
Prealbumin/TTR Rabbit Polyclonal Antibody (Fluoro647)
orb3075926 100 µg

Prealbumin/TTR Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
DNA PKcs (PRKDC) pTyr2609 Rabbit Polyclonal Antibody
AP20936PU-N 100 µg

DNA PKcs (PRKDC) pTyr2609 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Spectrin β II (h) -PR
sc-36551-PR 10 µM - 20 µL

Spectrin β II (h) -PR

Sign In for Pricing
View Details
Anti-human TNFRSF9 / 4-1BB / CD137 (Utomilumab Biosimilar)
orb2829068-01 1 mg

Anti-human TNFRSF9 / 4-1BB / CD137 (Utomilumab Biosimilar)

Sign In for Pricing
View Details