Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UDP-glucuronosyltransferase 3A2 (UGT3A2), partial

Product Specifications

Product Name Alternative

UDPGT 3A2; UGT3A2; PSEC0073, UNQ842/PRO1780

Abbreviation

Recombinant Human UGT3A2 protein, partial

Gene Name

UGT3A2

UniProt

Q3SY77

Expression Region

23-483aa

Organism

Homo sapiens (Human)

Target Sequence

AKILTISTVGGSHYLLMDRVSQILQDHGHNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEETLGGRGKFENLLNVLEYLALQCSHFLNRKDIMDSLKNENFDMVIVETFDYCPFLIAEKLGKPFVAILSTSFGSLEFGLPIPLSYVPVFRSLLTDHMDFWGRVKNFLMFFSFCRRQQHMQSTFDNTIKEHFTEGSRPVLSHLLLKAELWFINSDFAFDFARPLLPNTVYVGGLMEKPIKPVPQDLENFIAKFGDSGFVLVTLGSMVNTCQNPEIFKEMNNAFAHLPQGVIWKCQCSHWPKDVHLAANVKIVDWLPQSDLLAHPSIRLFVTHGGQNSIMEAIQHGVPMVGIPLFGDQPENMVRVEAKKFGVSIQLKKLKAETLALKMKQIMEDKRYKSAAVAASVILRSHPLSPTQRLVGWIDHVLQTGGATHLKPYVFQQPWHEQ

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Relevance

UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

59.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC22A1 Polyclonal Antibody
E-AB-91780-01 60 µL

SLC22A1 Polyclonal Antibody

Sign In for Pricing
View Details
SLC22A1 Polyclonal Antibody
E-AB-91780-02 120 µL

SLC22A1 Polyclonal Antibody

Sign In for Pricing
View Details
SLC22A1 Polyclonal Antibody
E-AB-91780-03 200 µL

SLC22A1 Polyclonal Antibody

Sign In for Pricing
View Details
Rab31 ORF Vector (Mouse) (pORF)
ORF055422 1.0 µg DNA

Rab31 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to S100 Calcium Binding Protein A11 (S100A11)
MBS2044315-01 0.1 mL

FITC-Linked Polyclonal Antibody to S100 Calcium Binding Protein A11 (S100A11)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to S100 Calcium Binding Protein A11 (S100A11)
MBS2044315-02 0.2 mL

FITC-Linked Polyclonal Antibody to S100 Calcium Binding Protein A11 (S100A11)

Sign In for Pricing
View Details