Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prohibitin-2 (PHB2)

Product Specifications

Product Name Alternative

B-cell receptor-associated protein BAP37; D-prohibitin; Repressor of estrogen receptor activity

Abbreviation

Recombinant Human PHB2 protein

Gene Name

PHB2

UniProt

Q99623

Expression Region

1-299aa

Organism

Homo sapiens (Human)

Target Sequence

MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Protein with pleiotropic attributes mediated in a cell-compartment- and tissue-specific manner, which include the plasma membrane-associated cell signaling functions, mitochondrial chaperone, and transcriptional co-regulator of transcription factors and sex steroid hormones in the nucleus

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori Equine Annexin V ELISA Kit
GR106918 96 Well

Nori Equine Annexin V ELISA Kit

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Cysteine--tRNA ligase (cysS)
MBS1056799-01 0.02 mg (E-Coli)

Recombinant Pseudomonas aeruginosa Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Cysteine--tRNA ligase (cysS)
MBS1056799-02 0.02 mg (Yeast)

Recombinant Pseudomonas aeruginosa Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Cysteine--tRNA ligase (cysS)
MBS1056799-03 0.1 mg (E-Coli)

Recombinant Pseudomonas aeruginosa Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Cysteine--tRNA ligase (cysS)
MBS1056799-04 0.1 mg (Yeast)

Recombinant Pseudomonas aeruginosa Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Cysteine--tRNA ligase (cysS)
MBS1056799-05 0.02 mg (Baculovirus)

Recombinant Pseudomonas aeruginosa Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details