Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Growth/differentiation factor 11 (Gdf11)

Product Specifications

Product Name Alternative

Bone morphogenetic protein 11

Abbreviation

Recombinant Mouse Gdf11 protein

Gene Name

Gdf11

UniProt

Q9Z1W4

Expression Region

297-405aa

Organism

Mus musculus (Mouse)

Target Sequence

NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Secreted signal that acts globally to regulate anterior/posterior axial patterning during development. May play critical roles in patterning both mesodermal and neural tissues. It is required for proper vertebral patterning and orofacial development. Signals through activin receptors type-2, ACVR2A and ACVR2B, and activin receptors type-1, ACVR1B, ACVR1C and TGFBR1 leading to the phosphorylation of SMAD2 and SMAD3

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CC113, CT (CCDC113, Coiled-coil domain-containing protein 113) (AP) discontinued
033262-AP 200 µL

CC113, CT (CCDC113, Coiled-coil domain-containing protein 113) (AP) discontinued

Sign In for Pricing
View Details
Mouse B-cell leukemia/lymphoma 2, Bcl-2 ELISA Kit
CK-bio-15755-01 48 Tests

Mouse B-cell leukemia/lymphoma 2, Bcl-2 ELISA Kit

Sign In for Pricing
View Details
Mouse B-cell leukemia/lymphoma 2, Bcl-2 ELISA Kit
CK-bio-15755-02 96 Tests

Mouse B-cell leukemia/lymphoma 2, Bcl-2 ELISA Kit

Sign In for Pricing
View Details
Mouse B-cell leukemia/lymphoma 2, Bcl-2 ELISA Kit
CK-bio-15755-03 5x 96 Tests

Mouse B-cell leukemia/lymphoma 2, Bcl-2 ELISA Kit

Sign In for Pricing
View Details
Mouse B-cell leukemia/lymphoma 2, Bcl-2 ELISA Kit
CK-bio-15755-04 10x 96 Tests

Mouse B-cell leukemia/lymphoma 2, Bcl-2 ELISA Kit

Sign In for Pricing
View Details
S100 A8 Mouse mAb (Mix-mA)
MBS9525795-01 0.04 mL

S100 A8 Mouse mAb (Mix-mA)

Sign In for Pricing
View Details