Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sorcin (SRI)

Product Specifications

Product Name Alternative

22 kDa protein; CP-22; V19

Abbreviation

Recombinant Human SRI protein

Gene Name

SRI

UniProt

P30626

Expression Region

1-198aa

Organism

Homo sapiens (Human)

Target Sequence

MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV

Tag

C-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Calcium-binding protein that modulates excitation-contraction coupling in the heart. Contributes to calcium homeostasis in the heart sarcoplasmic reticulum. Modulates the activity of RYR2 calcium channels

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

53.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMT2, CT (NMT2, Glycylpeptide N-tetradecanoyltransferase 2, Myristoyl-CoA:protein N-myristoyltransferase 2, Peptide N-myristoyltransferase 2, Type II N-myristoyltransferase) (MaxLight 750) discontinued
039035-ML750 100 µL

NMT2, CT (NMT2, Glycylpeptide N-tetradecanoyltransferase 2, Myristoyl-CoA:protein N-myristoyltransferase 2, Peptide N-myristoyltransferase 2, Type II N-myristoyltransferase) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal GLI-2 Antibody (524409) [Unconjugated]
MAB35262-SP 25 µg

Mouse Monoclonal GLI-2 Antibody (524409) [Unconjugated]

Sign In for Pricing
View Details
ATP1 alpha1/Na+K+ ATPase1 Antibody
MBS9610989-01 0.05 mL

ATP1 alpha1/Na+K+ ATPase1 Antibody

Sign In for Pricing
View Details
ATP1 alpha1/Na+K+ ATPase1 Antibody
MBS9610989-02 0.1 mL

ATP1 alpha1/Na+K+ ATPase1 Antibody

Sign In for Pricing
View Details
ATP1 alpha1/Na+K+ ATPase1 Antibody
MBS9610989-03 0.2 mL

ATP1 alpha1/Na+K+ ATPase1 Antibody

Sign In for Pricing
View Details
ATP1 alpha1/Na+K+ ATPase1 Antibody
MBS9610989-04 5x 0.2 mL

ATP1 alpha1/Na+K+ ATPase1 Antibody

Sign In for Pricing
View Details