Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heparanase (HPSE), partial

Product Specifications

Product Name Alternative

Endo-glucoronidase; Heparanase-1

Abbreviation

Recombinant Human HPSE protein, partial

Gene Name

HPSE

UniProt

Q9Y251

Expression Region

36-109aa

Organism

Homo sapiens (Human)

Target Sequence

QDVVDLDFFTQEPLHLVSPSFLSVTIDANLATDPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKE

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Tags & Cell Markers

Relevance

Endoglycosidase that cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans. Participates in extracellular matrix (ECM) degradation and remodeling. Selectively cleaves the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying either a 3-O-sulfo or a 6-O-sulfo group. Can also cleave the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying a 2-O-sulfo group, but not linkages between a glucuronic acid unit and a 2-O-sulfated iduronic acid moiety. It is essentially inactive at neutral pH but becomes active under acidic conditions such as during tumor invasion and in inflammatory processes. Facilitates cell migration associated with metastasis, wound healing and inflammation. Enhances shedding of syndecans, and increases endothelial invasion and angiogenesis in myelomas. Acts as a procoagulant by increasing the generation of activation factor X in the presence of tissue factor and activation factor VII. Increases cell adhesion to the extracellular matrix (ECM), independent of its enzymatic activity. Induces AKT1/PKB phosphorylation via lipid rafts increasing cell mobility and invasion. Heparin increases this AKT1/PKB activation. Regulates osteogenesis. Enhances angiogenesis through up-regulation of SRC-mediated activation of VEGF. Implicated in hair follicle inner root sheath differentiation and hair homeostasis

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

16-phenoxy tetranor Prostaglandin E2
T84588-01 10 mg

16-phenoxy tetranor Prostaglandin E2

Sign In for Pricing
View Details
16-phenoxy tetranor Prostaglandin E2
T84588-02 50 mg

16-phenoxy tetranor Prostaglandin E2

Sign In for Pricing
View Details
RSL24D1P6 3'UTR Luciferase Stable Cell Line
TU022426 1.0 mL

RSL24D1P6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Lipopolysaccharide Binding Protein ELISA Kit
MBS057808-01 48 Well

Mouse Lipopolysaccharide Binding Protein ELISA Kit

Sign In for Pricing
View Details
Mouse Lipopolysaccharide Binding Protein ELISA Kit
MBS057808-02 96 Well

Mouse Lipopolysaccharide Binding Protein ELISA Kit

Sign In for Pricing
View Details
Mouse Lipopolysaccharide Binding Protein ELISA Kit
MBS057808-03 5x 96 Well

Mouse Lipopolysaccharide Binding Protein ELISA Kit

Sign In for Pricing
View Details