Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclin-dependent kinase 12 (CDK12), partial

Product Specifications

Product Name Alternative

Cdc2-related kinase, arginine/serine-rich; Cell division cycle 2-related protein kinase 7; Cell division protein kinase 12

Abbreviation

Recombinant Human CDK12 protein, partial

Gene Name

CDK12

UniProt

Q9NYV4

Expression Region

727-1020aa

Organism

Homo sapiens (Human)

Target Sequence

FDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFL

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Cyclin-dependent kinase that phosphorylates the C-terminal domain (CTD) of the large subunit of RNA polymerase II (POLR2A), thereby acting as a key regulator of transcription elongation. Regulates the expression of genes involved in DNA repair and is required for the maintenance of genomic stability. Preferentially phosphorylates 'Ser-5' in CTD repeats that are already phosphorylated at 'Ser-7', but can also phosphorylate 'Ser-2'. Required for RNA splicing, possibly by phosphorylating SRSF1/SF2. Involved in regulation of MAP kinase activity, possibly leading to affect the response to estrogen inhibitors

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ndufa7 activation kit by CRISPRa
GA206767 1 Kit

Mouse Ndufa7 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Rrp7a activation kit by CRISPRa
GA210018 1 Kit

Mouse Rrp7a activation kit by CRISPRa

Sign In for Pricing
View Details
5-Bromo-2-picoline
TRC-B685590-5G 5 g

5-Bromo-2-picoline

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR562140 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
CHIC1 (NM_001039840) Human Over-expression Lysate
LC421834 20 µg

CHIC1 (NM_001039840) Human Over-expression Lysate

Sign In for Pricing
View Details
TFPI Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B10]
TA806093AM 100 µL

TFPI Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B10]

Sign In for Pricing
View Details