Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lutropin subunit beta (Lhb)

Product Specifications

Product Name Alternative

Luteinizing hormone subunit beta

Abbreviation

Recombinant Mouse Lhb protein

Gene Name

Lhb

UniProt

O09108

Expression Region

21-141aa

Organism

Mus musculus (Mouse)

Target Sequence

SRGPLRPLCRPVNATLAAENEFCPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELAFASVRLPGCPPGVDPIVSFPVALSCRCGPCRLSSSDCGGPRTQPMACDLPHLPGLLLL

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAIL (TNFSF10) Mouse Monoclonal Antibody [Clone ID: OTI2C12]
CF811772 100 µg

TRAIL (TNFSF10) Mouse Monoclonal Antibody [Clone ID: OTI2C12]

Sign In for Pricing
View Details
Human Centaurin beta 2 (ACAP2) activation kit by CRISPRa
GA108370 1 Kit

Human Centaurin beta 2 (ACAP2) activation kit by CRISPRa

Sign In for Pricing
View Details
C18orf1 (LDLRAD4) Rabbit Polyclonal Antibody
TA369865 100 µL

C18orf1 (LDLRAD4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), CF568 conjugate, 0.1mg/mL
BNC682075-500 1x 500 µL

MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), Biotin conjugate, 0.1mg/mL
BNCB2497-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAPKAP Kinase 3 (MAPKAPK3) Rabbit Polyclonal Antibody
AP06739PU-N 100 µg

MAPKAP Kinase 3 (MAPKAPK3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details