Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Lutropin subunit beta (Lhb)

Product Specifications

Product Name Alternative

Luteinizing hormone subunit beta

Abbreviation

Recombinant Rat Lhb protein

Gene Name

Lhb

UniProt

P01230

Expression Region

21-141aa

Organism

Rattus norvegicus (Rat)

Target Sequence

SRGPLRPLCRPVNATLAAENEFCPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPIVSFPVALSCRCGPCRLSSSDCGGPRTQPMTCDLPHLPGLLLF

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HGF / SF (EGH2 4C12.1), CF405S conjugate, 0.1mg/mL
BNC042841-500 1x 500 µL

HGF / SF (EGH2 4C12.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2714), CF405S conjugate, 0.1mg/mL
BNC042714-100 1x 100 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2714), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EASYStep Pro Rat Corticosterone (Cort) ELISA Kit
RDEp-Cort-Ra 96 Tests

EASYStep Pro Rat Corticosterone (Cort) ELISA Kit

Sign In for Pricing
View Details
BCL-XL (Ab-62) Antibody
8B7027-AAT 50 µg

BCL-XL (Ab-62) Antibody

Sign In for Pricing
View Details
CDS1 (NM_001263) Human Over-expression Lysate
LY420042 100 µg

CDS1 (NM_001263) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Pga5 activation kit by CRISPRa
GA206299 1 Kit

Mouse Pga5 activation kit by CRISPRa

Sign In for Pricing
View Details