Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Netrin receptor UNC5C (A150V), partial

Product Specifications

Product Name Alternative

Protein unc-5 homolog 3; Protein unc-5 homolog C

Abbreviation

Recombinant Human UNC5C protein (A150V), partial

Gene Name

UNC5C

UniProt

O95185-2

Expression Region

61-270aa (A150V)

Organism

Homo sapiens (Human)

Target Sequence

LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDYWCQCVAWSSVGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Developmental Biology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calponin-1 (Smooth Muscle Marker), CF640R conjugate, 0.1mg/mL
BNC401685-500 1x 500 µL

Calponin-1 (Smooth Muscle Marker), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (rGLUT1/2476), CF488A conjugate, 0.1mg/mL
BNC883795-100 1x 100 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (rGLUT1/2476), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KCNH1 Human Gene Knockout Kit (CRISPR)
KN415104 1 Kit

KCNH1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD20 (B9E9), 1mg/mL
BNUM0160-50 1x 50 µL

CD20 (B9E9), 1mg/mL

Sign In for Pricing
View Details
2-(1-Piperidino)aniline
TRC-P481935-100MG 100 mg

2-(1-Piperidino)aniline

Sign In for Pricing
View Details
Drebrin 1 (DBN1) (DBN1/3393), CF740 conjugate, 0.1mg/mL
BNC743393-100 1x 100 µL

Drebrin 1 (DBN1) (DBN1/3393), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details