Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protease serine 4 (TMPRSS4), partial

Product Specifications

Product Name Alternative

Channel-activating protease 2; Membrane-type serine protease 2

Abbreviation

Recombinant Human TMPRSS4 protein, partial

Gene Name

TMPRSS4

UniProt

Q9NRS4

Expression Region

54-437aa

Organism

Homo sapiens (Human)

Target Sequence

KVILDKYYFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWKAEL

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Plasma membrane-anchored serine protease that directly induces processing of pro-uPA/PLAU into the active form through proteolytic activity. Seems to be capable of activating ENaC

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

49.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Accuris qMAX Green One-Step RT-qPCR Kit, Low Rox, 1000 reactions
PR2120-L-1000 1 Each

Accuris qMAX Green One-Step RT-qPCR Kit, Low Rox, 1000 reactions

Sign In for Pricing
View Details
Bu-1b Mouse Monoclonal Antibody [Clone ID: 5-11G2]
AM08135PU-N 500 µg

Bu-1b Mouse Monoclonal Antibody [Clone ID: 5-11G2]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Ricinus communis Lectin (Castor Bean) -RCA-I-,  30nm
GP-2001-30 1 mL

Colloidal Gold Conjugated Ricinus communis Lectin (Castor Bean) -RCA-I-, 30nm

Sign In for Pricing
View Details
Human Tissue Inhibitors Of Metalloproteinase 2 (TIMP2) ELISA Kit
RDR-TIMP2-Hu-01 96 Tests

Human Tissue Inhibitors Of Metalloproteinase 2 (TIMP2) ELISA Kit

Sign In for Pricing
View Details
Human Tissue Inhibitors Of Metalloproteinase 2 (TIMP2) ELISA Kit
RDR-TIMP2-Hu-02 48 Tests

Human Tissue Inhibitors Of Metalloproteinase 2 (TIMP2) ELISA Kit

Sign In for Pricing
View Details
ZNF387 Antibody
8C10130-AAT 50 µg

ZNF387 Antibody

Sign In for Pricing
View Details