Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hevea brasiliensis Small rubber particle protein (SRPP)

Product Specifications

Product Name Alternative

22 kDa rubber particle protein;27 kDa natural rubber allergen; Latex allergen Hev b 3

Abbreviation

Recombinant Hevea brasiliensis SRPP protein

Gene Name

SRPP

UniProt

O82803

Expression Region

1-204aa

Organism

Hevea brasiliensis (Para rubber tree) (Siphonia brasiliensis)

Target Sequence

MAEEVEEERLKYLDFVRAAGVYAVDSFSTLYLYAKDISGPLKPGVDTIENVVKTVVTPVYYIPLEAVKFVDKTVDVSVTSLDGVVPPVIKQVSAQTYSVAQDAPRIVLDVASSVFNTGVQEGAKALYANLEPKAEQYAVITWRALNKLPLVPQVANVVVPTAVYFSEKYNDVVRGTTEQGYRVSSYLPLLPTEKITKVFGDEAS

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Involved in the biosynthesis of rubber, an isoprenoid polymer (cis-1,4-polyisoprene)

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey AQP-1 ELISA Kit
EMKA0870 96 Tests

Monkey AQP-1 ELISA Kit

Sign In for Pricing
View Details
MYH8 ELISA Kit (Human)
OKCD01761-96W 96 Well

MYH8 ELISA Kit (Human)

Sign In for Pricing
View Details
Itpr2 ORF Vector (Mouse) (pORF)
25206015 1.0 µg DNA

Itpr2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
RBM24 ORF Vector (Human) (pORF)
38620011 1.0 µg DNA

RBM24 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
9030619P08Rik (NM_001039720) Mouse Tagged ORF Clone Lentiviral Particle
MR214335L3V 200 µL

9030619P08Rik (NM_001039720) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Anti-Human CD4, Purified mAb Conjugated Antibody
MBS9439891-01 0.1 mL (Biotin)

Mouse Anti-Human CD4, Purified mAb Conjugated Antibody

Sign In for Pricing
View Details