Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus 30 Protein E7 (E7)

Product Specifications

Product Name Alternative

E7

Abbreviation

Recombinant Human papillomavirus 30 E7 protein

Gene Name

E7

UniProt

P36826

Expression Region

1-105aa

Organism

Human papillomavirus 30

Target Sequence

MHGKVTTIPEYILDLVPQTEIDLHCYEQLNSSEEEDEDEVDNLQKQPQQARQEEQHPCYLINTQCCRCASAVQLAVQSPTKELRALQQMLMGALELVCPLCATRR

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Also plays a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta)

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Grin3a siRNA Oligos set (Mouse)
22676174 3x 5 nmol

Grin3a siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
RXR antagonist 1
orb1686628-01 25 mg

RXR antagonist 1

Sign In for Pricing
View Details
RXR antagonist 1
orb1686628-02 50 mg

RXR antagonist 1

Sign In for Pricing
View Details
RXR antagonist 1
orb1686628-03 100 mg

RXR antagonist 1

Sign In for Pricing
View Details
Meikin Mouse shRNA Lentiviral Particle (Locus ID 74847)
TL519491V 500 µL Each

Meikin Mouse shRNA Lentiviral Particle (Locus ID 74847)

Sign In for Pricing
View Details
Mouse Ddr1 Pre-designed siRNA Set B
SI103488B 1 Each

Mouse Ddr1 Pre-designed siRNA Set B

Sign In for Pricing
View Details