Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Rhombotin-1 (LMO1)

Product Specifications

Product Name Alternative

Cysteine-rich protein TTG-1; LIM domain only protein 1; T-cell translocation protein 1

Abbreviation

Recombinant Human LMO1 protein

Gene Name

LMO1

UniProt

P25800

Expression Region

1-156aa

Organism

Homo sapiens (Human)

Target Sequence

MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laminin gamma 1 Antibody / LAMC1 / LAMB2
V2682-100UG 100 µg

Laminin gamma 1 Antibody / LAMC1 / LAMB2

Sign In for Pricing
View Details
KCTD1 Human shRNA Plasmid Kit (Locus ID 284252)
TR303797 1 Kit

KCTD1 Human shRNA Plasmid Kit (Locus ID 284252)

Sign In for Pricing
View Details
IQCF3 siRNA Oligos set (Human)
25053171 3x 5 nmol

IQCF3 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Mab Aspartate Decarboxylase-IN-1
orb1689414-01 1 mg

Mab Aspartate Decarboxylase-IN-1

Sign In for Pricing
View Details
Mab Aspartate Decarboxylase-IN-1
orb1689414-02 5 mg

Mab Aspartate Decarboxylase-IN-1

Sign In for Pricing
View Details
Mab Aspartate Decarboxylase-IN-1
orb1689414-03 1 ml x 10 mM (in DMSO)

Mab Aspartate Decarboxylase-IN-1

Sign In for Pricing
View Details