Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DNA-binding protein inhibitor ID-3 (ID3)

Product Specifications

Product Name Alternative

Class B basic helix-loop-helix protein 25; Helix-loop-helix protein HEIR-1; ID-like protein inhibitor HLH 1R21; Inhibitor of DNA binding 3; Inhibitor of differentiation 3

Abbreviation

Recombinant Human ID3 protein

Gene Name

ID3

UniProt

Q02535

Expression Region

1-119aa

Organism

Homo sapiens (Human)

Target Sequence

MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Involved in myogenesis by inhibiting skeletal muscle and cardiac myocyte differentiation and promoting muscle precursor cells proliferation. Inhibits the binding of E2A-containing protein complexes to muscle creatine kinase E-box enhancer. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-BMAL1 heterodimer

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex I,  5nm
GM-15-5 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex I, 5nm

Sign In for Pricing
View Details
IFITM2 Mouse Monoclonal Antibody [Clone ID: OTI6F7]
CF811629 100 µg

IFITM2 Mouse Monoclonal Antibody [Clone ID: OTI6F7]

Sign In for Pricing
View Details
Galamustine Hydrochloride (>85%)
TRC-G253470-50MG 50 mg

Galamustine Hydrochloride (>85%)

Sign In for Pricing
View Details
Efgartigimod Biosimilar - Research Grade
ICH5223-1mg 1 mg

Efgartigimod Biosimilar - Research Grade

Sign In for Pricing
View Details
CD83 Polyclonal Antibody
E-AB-67398-01 60 µL

CD83 Polyclonal Antibody

Sign In for Pricing
View Details
CD83 Polyclonal Antibody
E-AB-67398-02 120 µL

CD83 Polyclonal Antibody

Sign In for Pricing
View Details