Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Notechis scutatus scutatus Basic phospholipase A2 notechis II-5

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase

Abbreviation

Recombinant Notechis scutatus scutatus Basic phospholipase A2 notechis II-5 protein

UniProt

P00609

Expression Region

1-119aa

Organism

Notechis scutatus scutatus (Mainland tiger snake)

Target Sequence

NLVQFSYLIQCANHGRRPTRHYMDYGCYCGWGGSGTPVDELDRCCKIHDDCYSDAEKKGCSPKMSAYDYYCGENGPYCRNIKKKCLRFVCDCDVEAAFCFAKAPYNNANWNIDTKKRCQ

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Snake venom phospholipase A2 (PLA2) that inhibits neuromuscular transmission by blocking acetylcholine release from the nerve termini. Notechis II-5 is less toxic than notexin but has a higher specific phospholipase activity. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Src Polyclonal Rabbit Polyclonal Antibody
E53P05159 100 µL

Src Polyclonal Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hypoglycemic agent 1
HY-130003 1 Each

Hypoglycemic agent 1

Sign In for Pricing
View Details
(1RS,2RS,5R) -Menthol-1,2,6,6-d4
CS-C-00766 1 Each

(1RS,2RS,5R) -Menthol-1,2,6,6-d4

Sign In for Pricing
View Details
FAM175B Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV640458 1.0 µg DNA

FAM175B Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Cluster Of Differentiation 40 Ligand (CD40L) Magnetic Fluorescence Assay Kit
MBS2154864-01 96 Tests

Cluster Of Differentiation 40 Ligand (CD40L) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Cluster Of Differentiation 40 Ligand (CD40L) Magnetic Fluorescence Assay Kit
MBS2154864-02 5x 96 Tests

Cluster Of Differentiation 40 Ligand (CD40L) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details