Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Notechis scutatus scutatus Acidic phospholipase A2 HTe

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase

Abbreviation

Recombinant Notechis scutatus scutatus Acidic phospholipase A2 HTe protein

UniProt

Q9PSN5

Expression Region

1-125aa

Organism

Notechis scutatus scutatus (Mainland tiger snake)

Target Sequence

NLYQFGNMIQCANHGRRPTRHYMDYGCYCGKGGSGTPVDELDRCCQTHDDCYGEAEKLPACNYMMSGPYYNTYSYECNEGELTCKDNNDECKAFICNCDRTAAICFARAPYNDANWNIDTKTRCQ

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Snake venom phospholipase A2 (PLA2) that blocks neuromuscular transmission, but that does not produce blockade by virtue of a selective action on nerve endings. Instead, the toxin acts both on nerve and on muscle. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF555 conjugate, 0.1mg/mL
BNC551052-500 1x 500 µL

CD3e (B-B12), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF647 conjugate, 0.1mg/mL
BNC471052-100 1x 100 µL

CD3e (B-B12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL
BNC470669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF594 conjugate, 0.1mg/mL
BNC940994-100 1x 100 µL

TNF alpha (J2D10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (115D8), CF594 conjugate, 0.1mg/mL
BNC940612-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (115D8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF594 conjugate, 0.1mg/mL
BNC942400-500 1x 500 µL

OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details