Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Adelphocoris lineolatus Odorant-binding protein 1

Product Specifications

Abbreviation

Recombinant Adelphocoris lineolatus Odorant-binding protein 1

UniProt

F4Y5P0

Expression Region

19-145aa

Organism

Adelphocoris lineolatus (Alfalfa plant bug)

Target Sequence

DEQTNAMVAKAFNKCREEFPISDDEIGGVREKTTIPESHNAKCLMACMLREGKMLRDGKYEKENALIMADVLNKDDPASADKAKQLVETCAGKVGTDAGGDECEFAYKMAVCAAEEAKKLGVRPPDF

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Laminin α2 (LAMA2) ELISA Kit
YP-W100832-01 48 Tests

Human Laminin α2 (LAMA2) ELISA Kit

Sign In for Pricing
View Details
Human Laminin α2 (LAMA2) ELISA Kit
YP-W100832-02 96 Tests

Human Laminin α2 (LAMA2) ELISA Kit

Sign In for Pricing
View Details
Methyl (3R) -3-amino-3- (3-bromophenyl) propanoate hydrochloride
VIB90900-01 0.5 g

Methyl (3R) -3-amino-3- (3-bromophenyl) propanoate hydrochloride

Sign In for Pricing
View Details
Methyl (3R) -3-amino-3- (3-bromophenyl) propanoate hydrochloride
VIB90900-02 5 g

Methyl (3R) -3-amino-3- (3-bromophenyl) propanoate hydrochloride

Sign In for Pricing
View Details
Mouse LPCAT3 (Lysophosphatidylcholine Acyltransferase 3) ELISA Kit
EM23168 96 Tests

Mouse LPCAT3 (Lysophosphatidylcholine Acyltransferase 3) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human CD130/IL6ST Protein, C-Fc
HW398011-01 50 µg

Recombinant Human CD130/IL6ST Protein, C-Fc

Sign In for Pricing
View Details