Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor receptor 3 (FGFR3), partial (Active)

Product Specifications

Product Name Alternative

Fibroblast growth factor receptor 3; EC:2.7.10.1; FGFR-3; CD333; FGFR3; JTK4

Abbreviation

Recombinant Human FGFR3 protein, partial (Active)

Gene Name

FGFR3

UniProt

P22607

Expression Region

23-375aa

Organism

Homo sapiens (Human)

Target Sequence

ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Tyrosine-protein kinase that acts as a cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of cell proliferation, differentiation and apoptosis. Plays an essential role in the regulation of chondrocyte differentiation, proliferation and apoptosis, and is required for normal skeleton development. Regulates both osteogenesis and postnatal bone mineralization by osteoblasts. Promotes apoptosis in chondrocytes, but can also promote cancer cell proliferation. Required for normal development of the inner ear. Phosphorylates PLCG1, CBL and FRS2. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Plays a role in the regulation of vitamin D metabolism. Mutations that lead to constitutive kinase activation or impair normal FGFR3 maturation, internalization and degradation lead to aberrant signaling. Over-expressed or constitutively activated FGFR3 promotes activation of PTPN11/SHP2, STAT1, STAT5A and STAT5B. Secreted isoform 3 retains its capacity to bind FGF1 and FGF2 and hence may interfere with FGF signaling.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human FGFR3 at 2 μg/mL can bind Anti-FGFR3 recombinant antibody (CSB-RA008646MA1HU) . The EC50 is 0.6767-0.8946 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.5 kDa

References & Citations

Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Wilson R.K. Nature 434:724-731 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PDE4B Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-62409R-APC-Cy5.5 100 µL

PDE4B Recombinant Antibody, APC-Cy5.5 Conjugated

Ask
View Details
Recombinant Human EpCAM/TROP-1 Protein (His Tag)
PDMH100313-01 20 µg

Recombinant Human EpCAM/TROP-1 Protein (His Tag)

Ask
View Details
Recombinant Human EpCAM/TROP-1 Protein (His Tag)
PDMH100313-02 100 µg

Recombinant Human EpCAM/TROP-1 Protein (His Tag)

Ask
View Details
Recombinant Human EpCAM/TROP-1 Protein (His Tag)
PDMH100313-03 500 µg

Recombinant Human EpCAM/TROP-1 Protein (His Tag)

Ask
View Details
Recombinant Human EpCAM/TROP-1 Protein (His Tag)
PDMH100313-04 1 mg

Recombinant Human EpCAM/TROP-1 Protein (His Tag)

Ask
View Details
HRP-Linked Monoclonal Antibody to Clara Cell Protein 16 (CC16)
MBS2167956-01 0.1 mL

HRP-Linked Monoclonal Antibody to Clara Cell Protein 16 (CC16)

Ask
View Details