Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Conus radiatus Iota-conotoxin-like r11c

Product Specifications

Product Name Alternative

R11.4

Abbreviation

Recombinant Conus radiatus Iota-conotoxin-like r11c protein

UniProt

Q7Z096

Expression Region

37-79aa

Organism

Conus radiatus (Rayed cone)

Target Sequence

GPSFCKADEKPCKYHADCCNCCLGGICKPSTSWIGCSTNVFLT

Tag

C-terminal 6xHis-PDI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Iota-conotoxins bind to voltage-gated sodium channels (Nav) and act as agonists by shifting the voltage-dependence of activation to more hyperpolarized levels. Causes circular motion, convulsions, copious urination, rigid paralysis and death upon intracranial injection into mice. Causes unbalanced swimming, swimming in diagonal and vertical motion and death, when injected intraperitoneally into goldfish. L-Leu and D-Leu forms are active on both nerve and muscle.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

62 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
BNC400050-500 1x 500 µL

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-500 1x 500 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
BNC551037-500 1x 500 µL

CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
BNC940009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (Cocktail PAN-CK), CF488A conjugate, 0.1mg/mL
BNC880999-100 1x 100 µL

Cytokeratin, pan (Cocktail PAN-CK), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (JC/70A), CF488A conjugate, 0.1mg/mL
BNC880639-500 1x 500 µL

CD31 / PECAM-1 (JC/70A), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details