Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Serine protease 1 (PRSS1)

Product Specifications

Product Name Alternative

Anionic trypsin I; Anionic trypsin-1; Beta-trypsin; Cationic trypsinogen; Pretrypsinogen I; Trypsin I; Trypsin-1

Abbreviation

Recombinant Dog PRSS1 protein

Gene Name

PRSS1

UniProt

P06871

Expression Region

24-246aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

IVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKIIRHPRYNANTIDNDIMLIKLSSPATLNSRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKAPILSDSVCRNAYPGQISSNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVSPKVCKYVSWIQQTIAAN

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit EPHA10 (Ephrin Type A Receptor 10) ValidElisa Kit
EK347191 96 Well

Rabbit EPHA10 (Ephrin Type A Receptor 10) ValidElisa Kit

Sign In for Pricing
View Details
Rabbit Monoclonal EBAG9/RCAS1 Antibody (EBAG9/7033R) [DyLight 488]
NBP3-14064G 0.1 mL

Rabbit Monoclonal EBAG9/RCAS1 Antibody (EBAG9/7033R) [DyLight 488]

Sign In for Pricing
View Details
CNBP sgRNA CRISPR Lentivector set (Human)
K0473901 3x 1.0 µg

CNBP sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal PSF1 Antibody [DyLight 755]
NBP2-32156IR 0.1 mL

Rabbit Polyclonal PSF1 Antibody [DyLight 755]

Sign In for Pricing
View Details
COMT (m) -PR
sc-77372-PR 10 µM - 20 µL

COMT (m) -PR

Sign In for Pricing
View Details
Sumo2/3/4 Peptide
DF8750-BP 1 mg

Sumo2/3/4 Peptide

Sign In for Pricing
View Details