Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H3.1 (H3C1)

Product Specifications

Product Name Alternative

Histone H3/a; Histone H3/b; Histone H3/c; Histone H3/d; Histone H3/f; Histone H3/h; Histone H3/i; Histone H3/j; Histone H3/k; Histone H3/l

Abbreviation

Recombinant Human H3C1 protein

Gene Name

H3C1

UniProt

P68431

Expression Region

2-136aa

Organism

Homo sapiens (Human)

Target Sequence

ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SPATA8 Human qPCR Primer Pair (NM_173499)
HP218320 200 Reactions

SPATA8 Human qPCR Primer Pair (NM_173499)

Ask
View Details
Digital Colorimeter
2053320/2 1 Each

Digital Colorimeter

Ask
View Details
MUC1, phosphorylated (pY1229) (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin, CD227, Mucin-1 subunit alpha, Mucin-1 subunit beta, MUC1-CT) (APC) discontinued
038689-APC 200 µL

MUC1, phosphorylated (pY1229) (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin, CD227, Mucin-1 subunit alpha, Mucin-1 subunit beta, MUC1-CT) (APC) discontinued

Ask
View Details
UXS1, CT (UXS1, UDP-glucuronic acid decarboxylase 1, UDP-glucuronate decarboxylase 1) (MaxLight 750)
MBS6362167-01 0.1 mL

UXS1, CT (UXS1, UDP-glucuronic acid decarboxylase 1, UDP-glucuronate decarboxylase 1) (MaxLight 750)

Ask
View Details
UXS1, CT (UXS1, UDP-glucuronic acid decarboxylase 1, UDP-glucuronate decarboxylase 1) (MaxLight 750)
MBS6362167-02 5x 0.1 mL

UXS1, CT (UXS1, UDP-glucuronic acid decarboxylase 1, UDP-glucuronate decarboxylase 1) (MaxLight 750)

Ask
View Details
DNAAF10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B9]
TA809523BM 100 µL

DNAAF10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B9]

Ask
View Details