Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribosomal protein eL39-like 2 (RPL39L)

Product Specifications

Product Name Alternative

60S ribosomal protein L39-2; Large ribosomal subunit protein eL39-like

Abbreviation

Recombinant Human RPL39L protein

Gene Name

RPL39L

UniProt

Q96EH5

Expression Region

1-51aa

Organism

Homo sapiens (Human)

Target Sequence

MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL
BNC741045-500 1x 500 µL

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
BNC400226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-500 1x 500 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2729R), CF640R conjugate, 0.1mg/mL
BNC402729-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2729R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-500 1x 500 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (GA-5), CF740 conjugate, 0.1mg/mL
BNC740167-500 1x 500 µL

GFAP (GA-5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details