Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mucin-1 (Muc1), partial

Product Specifications

Product Name Alternative

MUC-1; Episialin; CD antigen CD227; MUC1-NT; MUC1-alpha; MUC1-beta; MUC1-CT

Abbreviation

Recombinant Mouse Muc1 protein, partial

Gene Name

Muc1

UniProt

Q02496

Expression Region

21-535aa

Organism

Mus musculus (Mouse)

Target Sequence

FLALPSEENSVTSSQDTSSSLASTTTPVHSSNSDPATRPPGDSTSSPVQSSTSSPATRAPEDSTSTAVLSGTSSPATTAPVNSASSPVAHGDTSSPATSLSKDSNSSPVVHSGTSSAATTAPVDSTSSPVVHGGTSSPATSPPGDSTSSPDHSSTSSPATRAPEDSTSTAVLSGTSSPATTAPVDSTSSPVAHDDTSSPATSLSEDSASSPVAHGGTSSPATSPLRDSTSSPVHSSASIQNIKTTSDLASTPDHNGTSVTTTSSALGSATSPDHSGTSTTTNSSESVLATTPVYSSMPFSTTKVTSGSAIIPDHNGSSVLPTSSVLGSATSLVYNTSAIATTPVSNGTQPSVPSQYPVSPTMATTSSHSTIASSSYYSTVPFSTFSSNSSPQLSVGVSFFFLSFYIQNHPFNSSLEDPSSNYYQELKRNISGLFLQIFNGDFLGISSIKFRSGSVVVESTVVFREGTFSASDVKSQLIQHKKEADDYNLTISEVKVNEMQFPPSAQSRPGVPGWG

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

The alpha subunit has cell adhesive properties. Can act both as an adhesion and an anti-adhesion protein. May provide a protective layer on epithelial cells against bacterial and enzyme attack.; The beta subunit contains a C-terminal domain which is involved in cell signaling, through phosphorylations and protein-protein interactions. Modulates signaling in ERK, Src and NF-kappaB pathways. In activated T-cells, influences directly or indirectly the Ras/MAPK pathway. Regulates P53-mediated transcription and determines cell fate in the genotoxic stress response. Binds, together with KLF4, the PE21 promoter element of P53 and represses P53 activity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

53 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

c Fos (FOS) Mouse Monoclonal Antibody [Clone ID: OTI2D2]
CF806833 100 µg

c Fos (FOS) Mouse Monoclonal Antibody [Clone ID: OTI2D2]

Sign In for Pricing
View Details
ERK1/2 Polyclonal Antibody
E-AB-12397-01 20 µL

ERK1/2 Polyclonal Antibody

Sign In for Pricing
View Details
ERK1/2 Polyclonal Antibody
E-AB-12397-02 60 µL

ERK1/2 Polyclonal Antibody

Sign In for Pricing
View Details
ERK1/2 Polyclonal Antibody
E-AB-12397-03 120 µL

ERK1/2 Polyclonal Antibody

Sign In for Pricing
View Details
ERK1/2 Polyclonal Antibody
E-AB-12397-04 200 µL

ERK1/2 Polyclonal Antibody

Sign In for Pricing
View Details
RYK (NM_002958) Human Recombinant Protein
TP315509L 1 mg

RYK (NM_002958) Human Recombinant Protein

Sign In for Pricing
View Details