Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse eIF5-mimic protein 2 (Bzw1)

Product Specifications

Product Name Alternative

Basic leucine zipper and W2 domain-containing protein 1

Abbreviation

Recombinant Mouse Bzw1 protein

Gene Name

Bzw1

UniProt

Q9CQC6

Expression Region

1-419aa

Organism

Mus musculus (Mouse)

Target Sequence

MNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRRYAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLEKGFEDEVKKLLLFLKGFSESERNKLAMLTGVLLANGTLNASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAASLRKVSMDNRLMELFPANKQSVEHFTKYFTEAGLKELSEYVRNQQTIGARKELQKELQEQMSRGDPFKDIILYVKEEMKKNNIPEPVVIGIVWSSVMSTVEWNKKEELVAEQAIKHLKQYSPLLAAFTTQGQSELTLLLKIQEYCYDNIHFMKAFQKIVVLFYKAEVLSEEPILKWYKDAHVAKGKSVFLEQMKKFVEWLKNAEEESESEAEEGD

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Translation initiation regulator which represses repeat-associated non-AUG (RAN) initiated translation probably by acting as a competitive inhibitor of eukaryotic translation initiation factor 5 (EIF5) function. Enhances histone H4 gene transcription but does not seem to bind DNA directly.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

55 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD300LF Protein, hFc Tag
32-18267-100 100 µg

Human CD300LF Protein, hFc Tag

Sign In for Pricing
View Details
RatNP-3b sgRNA CRISPR Lentivector (Rat) (Target 3)
K6288304 1.0 µg DNA

RatNP-3b sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
CRBN ligand-373
HY-W953146 1 Each

CRBN ligand-373

Sign In for Pricing
View Details
M Antibody, FITC conjugated
A51318-50UL 50 μL

M Antibody, FITC conjugated

Sign In for Pricing
View Details
NUDT16 Adenovirus (Rat)
32284056 1.0 mL

NUDT16 Adenovirus (Rat)

Sign In for Pricing
View Details
APG5L (4W9) Rabbit Monoclonal Antibody
E28M1089 100 µL

APG5L (4W9) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details