Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia phage MS2 Capsid protein

Product Specifications

Product Name Alternative

CP; Coat protein

Abbreviation

Recombinant Escherichia phage MS2 Capsid protein

UniProt

P03612

Expression Region

2-130aa

Organism

Escherichia phage MS2 (Bacteriophage MS2)

Target Sequence

ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Capsid protein self-assembles to form an icosahedral capsid with a T=3 symmetry, about 26 nm in diameter, and consisting of 89 capsid proteins dimers (178 capsid proteins) . Involved in viral genome encapsidation through the interaction between a capsid protein dimer and the multiple packaging signals present in the RNA genome. The capsid contains also 1 copy of the A2 maturation protein. ; Acts as a translational repressor of viral replicase synthesis late in infection. This latter function is the result of capsid protein interaction with an RNA hairpin which contains the replicase ribosome-binding site.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAPA1 (CD81) Rabbit Polyclonal Antibody
AP31748PU-N 50 µL

TAPA1 (CD81) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS805550 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Uncoated Mouse GFAP (glial fibrillary acidic protein) ELISA Kit
E-UNEL-M0185-01 5x 96 Tests

Uncoated Mouse GFAP (glial fibrillary acidic protein) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse GFAP (glial fibrillary acidic protein) ELISA Kit
E-UNEL-M0185-02 15x 96 Tests

Uncoated Mouse GFAP (glial fibrillary acidic protein) ELISA Kit

Sign In for Pricing
View Details
Purified Anti-Human CD45 Antibody[BC8]
E-AB-F13720P-01 25 µg

Purified Anti-Human CD45 Antibody[BC8]

Sign In for Pricing
View Details
Purified Anti-Human CD45 Antibody[BC8]
E-AB-F13720P-02 100 µg

Purified Anti-Human CD45 Antibody[BC8]

Sign In for Pricing
View Details