Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytochrome P450 2C70 (Cyp2c70)

Product Specifications

Product Name Alternative

CYPIIC70

Abbreviation

Recombinant Mouse Cyp2c70 protein

Gene Name

Cyp2c70

UniProt

Q91W64

Expression Region

28-489aa

Organism

Mus musculus (Mouse)

Target Sequence

KLPPGPTPLPIVGNILQVDVKNISKSMGMLAKKYGPVFTVYLGMKPTVVLHGYKAMKEALIDQGDEFSDKTDSSLLSRTSQGLGIVFSNGETWKQTRRFSLMVLRSMGMGKKTIEDRIQEEILYMLDALRKTNGSPCDPSFLLACVPCNVISTVIFQHRFDYNDQTFQDFMENFHRKIEILASPWSQLCSAYPILYYLPGIHNRFLKDVTQQKKFILEEINRHQKSLDLSNPQDFIDYFLIKMEKEKHNQKSEFTMDNLVVSIGDLFGAGTETTSSTVKYGLLLLLKYPEVTAKIQEEIAHVIGRHRRPTMQDRNHMPYTDAVLHEIQRYIDFVPIPSPRKTTQDVEFRGYHIPKGTSVMACLTSVLNDDKEFPNPEKFDPGHFLDEKGNFKKSDYFVAFSAGRRACIGEGLARMEMFLILTNILQHFTLKPLVKPEDIDTKPVQTGLLHVPPPFELCFIPV

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

A cytochrome P450 monooxygenase involved in muricholic acid (MCA) synthesis. Hydroxylates at the 6-beta position two major bile acids, chenodeoxycholic acid (CDCA) and ursodeoxycholic acid (UDCA) to form alpha-MCA and beta-MCA, respectively. May regulate NR1H4/farnesoid X receptor signaling, as taurine-conjugated MCAs are antagonists of NR1H4. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

59.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
BNC041820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
BNC940304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-500 1x 500 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL
BNC740008-500 1x 500 µL

MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-500 1x 500 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details