Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ferritin heavy chain (Fth1)

Product Specifications

Product Name Alternative

Ferritin H subunit

Abbreviation

Recombinant Mouse Fth1 protein

Gene Name

Fth1

UniProt

P09528

Expression Region

1-182aa

Organism

Mus musculus (Mouse)

Target Sequence

MTTASPSQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAEYLFDKHTLGHGDES

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Also plays a role in delivery of iron to cells. Mediates iron uptake in capsule cells of the developing kidney.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Shisa6 Mouse Gene Knockout Kit (CRISPR)
KN515754 1 Kit

Shisa6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,3-O-Bis(triisopropylsilyl) Glycerol
TRC-T296350-5G 5 g

1,3-O-Bis(triisopropylsilyl) Glycerol

Sign In for Pricing
View Details
Human NSG2 (HMP19) activation kit by CRISPRa
GA109904 1 Kit

Human NSG2 (HMP19) activation kit by CRISPRa

Sign In for Pricing
View Details
SLCO1B3 Human Gene Knockout Kit (CRISPR)
KN422317 1 Kit

SLCO1B3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human CD155/PVR/NECL5 Protein (mFc Tag)
PKSH033561-01 10 µg

Recombinant Human CD155/PVR/NECL5 Protein (mFc Tag)

Sign In for Pricing
View Details
Recombinant Human CD155/PVR/NECL5 Protein (mFc Tag)
PKSH033561-02 50 µg

Recombinant Human CD155/PVR/NECL5 Protein (mFc Tag)

Sign In for Pricing
View Details