Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cavia porcellus Lipocalin Cav p 2.0101 (Lcncavp2)

Product Specifications

Product Name Alternative

Major allergen Cav p 2; allergen Cav p 2.0101

Abbreviation

Recombinant Guinea pig Lcncavp2 protein

Gene Name

Lcncavp2

UniProt

P83508

Expression Region

17-170aa

Organism

Cavia porcellus (Guinea pig)

Target Sequence

DSIDYSKVPGNWRTIAIAADHVEKIEVNGELRAYFRQVDCTEGCDKISITFYTNTDGVCTEHTVVGARNGENDVYTVDYAGENTFQILCNSDDAFVIGSVNTDQNGQTTKEVAIAAKRNFLTPEQEQKFQKAVQNAGIPLENIRYVIETDTCPD

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plant Semaphorin 4B (SEMA4B) ELISA Kit
MBS9378909 Inquire

Plant Semaphorin 4B (SEMA4B) ELISA Kit

Sign In for Pricing
View Details
PUSL1, CT (PUSL1, tRNA pseudouridine synthase-like 1, tRNA pseudouridylate synthase-like 1, tRNA-uridine isomerase-like 1) (MaxLight 750) discontinued
040694-ML750 100 µL

PUSL1, CT (PUSL1, tRNA pseudouridine synthase-like 1, tRNA pseudouridylate synthase-like 1, tRNA-uridine isomerase-like 1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Cldn17 shRNA (UAS) - Lentiviral mouse Cldn17 shRNA (UAS, iRFP) (100)
GTR15208863 1 Vial

Lentiviral mouse Cldn17 shRNA (UAS) - Lentiviral mouse Cldn17 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Prss32 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
37844154 3x 1.0 µg DNA

Prss32 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
PPT2 (NM_005155) Human Untagged Clone
SC320220 10 µg

PPT2 (NM_005155) Human Untagged Clone

Sign In for Pricing
View Details
Pde1b 3'UTR Luciferase Stable Cell Line
TU215989 1.0 mL

Pde1b 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details