Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform (PPP2R2A)

Product Specifications

Product Name Alternative

PP2A subunit B isoform B55-alpha; PP2A subunit B isoform PR55-alpha; PP2A subunit B isoform R2-alpha; PP2A subunit B isoform alpha

Abbreviation

Recombinant Human PPP2R2A protein

Gene Name

PPP2R2A

UniProt

P63151

Expression Region

2-447aa

Organism

Homo sapiens (Human)

Target Sequence

AGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENIIAVATTNNLYIFQDKVN

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. Essential for serine/threonine-protein phosphatase 2A-mediated dephosphorylation of WEE1, preventing its ubiquitin-mediated proteolysis, increasing WEE1 protein levels, and promoting the G2/M checkpoint.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

58.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2,3,3,4,4,5,5-Octafluoro-1-pentanol
TRC-O273118-500MG 500 mg

2,2,3,3,4,4,5,5-Octafluoro-1-pentanol

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2808R), Biotin conjugate, 0.1mg/mL
BNCB2808-100 1x 100 µL

Cytokeratin 18 (KRT18) (KRT18/2808R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/294), CF488A conjugate, 0.1mg/mL
BNC881836-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/294), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-3/HER3 (C-mFc)
PKSH033965-01 10 µg

Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-3/HER3 (C-mFc)

Sign In for Pricing
View Details
Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-3/HER3 (C-mFc)
PKSH033965-02 50 µg

Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-3/HER3 (C-mFc)

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR559796 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details