Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage 434 Protein rexA (rexA)

Product Specifications

Abbreviation

Recombinant Enterobacteria phage 434 rexA protein

Gene Name

RexA

UniProt

P68925

Expression Region

1-279aa

Organism

Enterobacteria phage 434 (Bacteriophage 434)

Target Sequence

MKNGFYATYRSKNKGKDKRSINLSVFLNSLLADNHHLQVGSNYLYIHKIDGKTFLFTKTNDKSLVQKINRSKASVEDIKNSLADDESLGFPSFLFVEGDTIGFARTVFGPTTSDLTDFLIGKGMSLSSGERVQIEPLMRGTTKDDVMHMHFIGRTTVKVEAKLPVFGDILKVLGATDIEGELFDSLDIVIKPKFKRDIKKVAKDIIFNPSPQFSDISLRAKDEAGDILTEHYLSEKGHLSAPLNKVTNAEIAEEMAYCYARMKSDILECFKRQVGKVKD

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Inhibits the growth of unrelated coliphages, including T4rII, T5lr, T1, and some mutants of T7, P22, phi-80, and lambda. It controls the activity of gene S and may inhibit the establishment of lysogeny by the repressor protein.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Timm17a (NM_019351) Rat Tagged ORF Clone
RR208695 10 µg

Timm17a (NM_019351) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Protein lap1 (Lap1), partial
MBS1343820 Inquire

Recombinant Drosophila melanogaster Protein lap1 (Lap1), partial

Sign In for Pricing
View Details
Human EBNA1BP2 AssayLite™ Antibody (PerCP Conjugate)
32790-05171 5x 30 µg

Human EBNA1BP2 AssayLite™ Antibody (PerCP Conjugate)

Sign In for Pricing
View Details
Mucin 1 Polyclonal Antibody
BT-AP05659-01 20 µL

Mucin 1 Polyclonal Antibody

Sign In for Pricing
View Details
Mucin 1 Polyclonal Antibody
BT-AP05659-02 50 µL

Mucin 1 Polyclonal Antibody

Sign In for Pricing
View Details
Mucin 1 Polyclonal Antibody
BT-AP05659-03 100 µL

Mucin 1 Polyclonal Antibody

Sign In for Pricing
View Details