Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Pup--protein ligase (pafA)

Product Specifications

Product Name Alternative

Proteasome accessory factor A; Pup-conjugating enzyme

Abbreviation

Recombinant Mycobacterium tuberculosis pafA protein

Gene Name

PafA

UniProt

P9WNU6

Expression Region

1-452aa

Organism

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Target Sequence

MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDSLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIESGVAFRDFSLDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYYTRAVEHLQTREPNAQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSHPKIAQLDLAYHDIKRGRGIFDLLQRKGLAARVTTDEEIAEAVDQPPQTTRARLRGEFISAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine. PafA is required to confer resistance against the lethal effects of reactive nitrogen intermediates (RNI), antimicrobial molecules produced by activated macrophages and other cell types.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

58.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-500 1x 500 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL
BNC401820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL
BNC041081-100 1x 100 µL

CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
BNC740034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF594 conjugate, 0.1mg/mL
BNC940322-100 1x 100 µL

CD3e (RIV9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-100 1x 100 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details