Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein AF-9 (MLLT3), partial

Product Specifications

Product Name Alternative

ALL1-fused gene from chromosome 9 protein; Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein; YEATS domain-containing protein 3

Abbreviation

Recombinant Human MLLT3 protein, partial

Gene Name

MLLT3

UniProt

P42568

Expression Region

1-138aa

Organism

Homo sapiens (Human)

Target Sequence

MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Chromatin reader component of the super elongation complex (SEC), a complex required to increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA. Specifically recognizes and binds acylated histone H3, with a preference for histone H3 that is crotonylated. Crotonylation marks active promoters and enhancers and confers resistance to transcriptional repressors. Recognizes and binds histone H3 crotonylated at 'Lys-9' (H3K9cr), and with slightly lower affinity histone H3 crotonylated at 'Lys-18' (H3K18cr) . Also recognizes and binds histone H3 acetylated and butyrylated at 'Lys-9' (H3K9ac and H3K9bu, respectively), but with lower affinity than crotonylated histone H3. In the SEC complex, MLLT3 is required to recruit the complex to crotonylated histones. Recruitment of the SEC complex to crotonylated histones promotes recruitment of DOT1L on active chromatin to deposit histone H3 'Lys-79' methylation (H3K79me) . Plays a key role in hematopoietic stem cell (HSC) maintenance by preserving, rather than confering, HSC stemness. Acts by binding to the transcription start site of active genes in HSCs and sustaining level of H3K79me2, probably by recruiting DOT1L.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACVR1 Monoclonal Antibody
BT-MCA3613-01 50 µL

ACVR1 Monoclonal Antibody

Sign In for Pricing
View Details
ACVR1 Monoclonal Antibody
BT-MCA3613-02 100 µL

ACVR1 Monoclonal Antibody

Sign In for Pricing
View Details
Polyclonal Antibody to Tau (Ab-262)
35-1453-50 50 μL

Polyclonal Antibody to Tau (Ab-262)

Sign In for Pricing
View Details
2,4-Dichloro-3- (trimethylsilyl) pyridine
OR1082491-01 250 mg

2,4-Dichloro-3- (trimethylsilyl) pyridine

Sign In for Pricing
View Details
2,4-Dichloro-3- (trimethylsilyl) pyridine
OR1082491-02 500 mg

2,4-Dichloro-3- (trimethylsilyl) pyridine

Sign In for Pricing
View Details
2,4-Dichloro-3- (trimethylsilyl) pyridine
OR1082491-03 1 g

2,4-Dichloro-3- (trimethylsilyl) pyridine

Sign In for Pricing
View Details